PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG722400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 310aa    MW: 33451.8 Da    PI: 4.8543
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG722400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF21.43.3e-0722531344
                         HHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
               SRF-TF 13 fskRrngilKKAeELSvLCdaevaviifsstg 44
                         f kR+ g+  KAe L + C+++v v+  ++ g
  Pavir.5KG722400.1.p 22 FMKRKDGLKRKAEALATRCGVDVMVVCTGPGG 53
                         99**************************9866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.05E-101989IPR002100Transcription factor, MADS-box
PfamPF003191.2E-82254IPR002100Transcription factor, MADS-box
PROSITE profilePS500668.5072254IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MTRGKGGPMR AAVNLRDPLA RFMKRKDGLK RKAEALATRC GVDVMVVCTG PGGRGDLDCW  60
PPKEAANEVA RRYSALDPSQ RAKHTEDLAA DVARRLAEER DKLARALEGG VAGALGSWDG  120
SLEAVSEERL QELLASIEGS LVATKNRVLE LQAPLGGAAD RATFLSVLVH DEDTVGIFVP  180
PRPQPRGEAD AGGGGLPPPP SKNPNSPNAE DAGDEVQILQ PPRDADADAE WMRGPVDGIK  240
KRPQPYNPAA YRTRIEYISV GRFVMELDAY EFIRFDLGMP PPCIAPKPLD DDDGEPLKLW  300
SWDNTMPTS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456823.11e-105hypothetical protein SORBIDRAFT_03g043520
TrEMBLK3XSP11e-122K3XSP1_SETIT; Uncharacterized protein
STRINGSi004941m1e-122(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1587778
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26650.12e-08AGAMOUS-like 36